PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 476620
Common NameARALYDRAFT_476620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 258aa    MW: 28540.9 Da    PI: 7.5762
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
476620genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.2e-1497141347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+Wk I+r + k Rt  q+ s+ qky
           476620  97 PWTEEEHKLFLLGLQRVGKGDWKGISRNFVKSRTSTQVASHAQKY 141
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.89190146IPR017930Myb domain
SuperFamilySSF466897.33E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-1793144IPR006447Myb domain, plants
SMARTSM007171.2E-994144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1096141IPR009057Homeodomain-like
PfamPF002491.4E-1097141IPR001005SANT/Myb domain
CDDcd001671.32E-897142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MADGSTSSSE STNACSGGGT RREIMLFGVR VVLDPMRKCV SLNNLSEYEQ TAETPKIDGE  60
DRDGQDMNKT PAGYASADEA LPISSSNVNR ERKRGVPWTE EEHKLFLLGL QRVGKGDWKG  120
ISRNFVKSRT STQVASHAQK YFIRRSNLNR RRRRSSLFDM TTDTVNLQSE DDQVLMQENT  180
SQLSSPVPEI NNFSIHPVMQ VFPEFPVPTG NQSYGQLTSS NLIKLVPLTF QSSPAPLSLN  240
LSLASSNLNE PSPSMHSA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00236DAPTransfer from AT1G74840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0700980.0AY070098.1 Arabidopsis thaliana putative myb-related transcription activator protein (At1g74840) mRNA, complete cds.
GenBankAY0963930.0AY096393.1 Arabidopsis thaliana putative myb-related transcription activator (At1g74840) mRNA, complete cds.
GenBankAY5195100.0AY519510.1 Arabidopsis thaliana MYB transcription factor (At1g74840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888994.10.0myb family transcription factor, partial
SwissprotQ2V9B02e-55MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLD7KS560.0D7KS56_ARALL; Myb family transcription factor (Fragment)
STRINGfgenesh2_kg.2__1750__AT1G74840.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.11e-138MYB_related family protein